accessibility menu, dialog, popup

UserName
Viewing profile as user:

SPE Plates

Plates that incorporate traditional SPE sorbents for compound separation from liquids in a 96-well format (standard or deep well); used with vacuum, positive pressure, or centrifugation.
Type 
  • (8)
  • (12)
  • (30)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (10)
  • (13)
  • (49)
  • (1)
  • (1)
  • (1)
  • (24)
  • (1)
  • (1)
  • (9)
  • (57)
  • (1)
  • (1)
Sorbent 
  • (5)
  • (2)
  • (10)
  • (10)
  • (3)
  • (13)
  • (9)
  • (8)
  • (6)
  • (1)
  • (7)
  • (8)
  • (1)
  • (7)
  • (4)
  • (4)
  • (5)
  • (4)
  • (11)
  • (10)
  • (9)
  • (1)
  • (1)
  • (2)
  • (4)
  • (3)
  • (2)
  • (2)
  • (5)
  • (5)
  • (5)
  • (5)
Product Line 
  • (4)
  • (102)
  • (38)
  • (19)
  • (5)
Particle Size 
  • (3)
  • (6)
  • (18)
  • (1)
  • (113)
  • (1)
Bed Weight 
  • (29)
  • (2)
  • (17)
  • (2)
  • (2)
  • (5)
  • (19)
  • (1)
  • (15)
  • (26)
  • (1)
  • (1)
  • (3)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (1)
  • (1)
  • (9)
  • (14)
  • (1)
  • (12)
  • (2)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (6)
  • (1)
  • (1)
  • (2)
  • (1)
  • (1)
  • (25)
  • (1)
  • (35)
  • (1)
  • (1)
  • (217)
  • (212)
  • (47)
  • (1)

special interests

  • (1)
  • (1)
  • (39)

special offers

  • (116)

Type

  • (8)
  • (12)
  • (30)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (10)
  • (13)
  • (49)
  • (1)
  • (1)
  • (1)
  • (24)
  • (1)
  • (1)
  • (9)
  • (57)
  • (1)
  • (1)

Sorbent

  • (5)
  • (2)
  • (10)
  • (10)
  • (3)
  • (13)
  • (9)
  • (8)
  • (6)
  • (1)
  • (7)
  • (8)
  • (1)
  • (7)
  • (4)
  • (4)
  • (5)
  • (4)
  • (11)
  • (10)
  • (9)
  • (1)
  • (1)
  • (2)
  • (4)
  • (3)
  • (2)
  • (2)
  • (5)
  • (5)
  • (5)
  • (5)

Product Line

  • (4)
  • (102)
  • (38)
  • (19)
  • (5)

Particle Size

  • (3)
  • (6)
  • (18)
  • (1)
  • (113)
  • (1)

Bed Weight

  • (29)
  • (2)
  • (17)
  • (2)
  • (2)
  • (5)
  • (19)
  • (1)
  • (15)
  • (26)
  • (1)
  • (1)
  • (3)

Volume (Metric) Well

  • (1)
  • (78)
  • (4)
  • (9)

Capture

  • (25)
  • (4)
  • (4)
  • (5)

Cleavage

  • (13)
  • (5)
  • (9)
  • (10)
  • (1)

Enzyme

  • (9)
  • (1)
  • (5)
  • (10)
  • (13)

Format

  • (1)
  • (1)
  • (1)
  • (9)
  • (7)
  • (7)
  • (6)
  • (6)
46 – 60 of 283 results
46

Thermo Scientific™ HyperSep™ Protein Precipitation Plate

Get a quick, effective approach for removal of proteins from biological compounds using the protein crash technique with these 96-well protein precipitation plates.

47
Promotions Available

Thermo Scientific™ HyperSep™ Retain PEP Plates

Get balanced retention for polar and nonpolar analytes with HyperSep Retain PEP Plates.

Particle Size 30 to 50 μm
Type Solid Phase Extraction Well Plate
Quantity 1 Pack
Volume (Metric) Well 1 mL
Sorbent HyperSep Urea-Modified Polystyrene DVB
For Use With (Application) Retention of Polar and Nonpolar Analytes
Product Line HyperSep
48
Promotions Available

Thermo Scientific™ HyperSep™ Cyano Plates

Get optimized isolation of polar compounds from nonpolar matrices, with these medium polarity cyano SPE well plates and individual wells.

Particle Size 40 to 60 μm
Type Solid Phase Extraction Well Plate
Volume (Metric) Well 1 mL
Sorbent HyperSep Cyano
For Use With (Application) Retention of Polar Compounds From Nonpolar Matrices
Product Line HyperSep
49
Promotions Available

Thermo Scientific™ HyperSep™ Retain CX Plates

Achieve consistent, high recoveries for basic compounds with these Thermo Scientific™ HyperSep™ Retain CX Plates.

Particle Size 30 to 50 μm
Type Solid Phase Extraction Well Plate
Volume (Metric) Well 1 mL
Sorbent HyperSep Sulfonic Acid-Modified Polystyrene DVB
For Use With (Application) Retention of Basic Analytes
Product Line HyperSep
50
Promotions Available

Thermo Scientific™ HyperSep™ Aminopropyl Plates

Obtain excellent retention of drugs, metabolites and structural isomers with these aminopropyl SPE well plates that allow both polar and anion exchange interactions.

Particle Size 40 to 60 μm
Type Solid Phase Extraction Well Plate
Volume (Metric) Well 1 mL
Sorbent HyperSep Aminopropyl
For Use With (Application) Extraction of Strong Acids via Polar and Anion Exchange Interactions
Product Line HyperSep
51
Promotions Available

Thermo Scientific™ HyperSep™ Verify CX Plates

Get improved analysis of drugs of abuse, including basic and neutral drugs, with these SPE well plates featuring both nonpolar and ionic separation characteristics.

Particle Size 40 to 60 μm
Type Solid Phase Extraction Well Plate
Volume (Metric) Well 1 mL
Sorbent HyperSep Reversed Phase C8/Benzene Sulfonic Acid Ion Exchanger
For Use With (Application) Analysis of Drugs of Abuse
Product Line HyperSep
54

Thermo Scientific™ HyperSep™ SPE Plates

Innovative HyperSep™ Solid Phase Extraction Plates deliver clean, highly reproducible sample extracts with lower elution volumes—for greater sensitivity, reliability and cost savings.

Type 96-well Plate
Bed Weight 10 mg
For Use With (Application) Bioanalytical Applications - Weak Ion-Exchange Retention of Strong Acidic Compounds. Sorbent Charge Can be Activated or Deactivated. Complementary Reversed Phase Retention of Neutral Compounds
Product Line HyperSep
55

Empore™ Sealing Tape for 96-well Plate, Sold by MilliporeSigma™ Supelco™

Designed for sealing unused portions of a 96-well filter/SPE plate during vacuum processing. Each sheet is comprised of a polypropylene fil coated with a synthetic rubber adhesive and is coupled with a liner tab for easy handling and dispensing

56

Invitrogen™ Human PGC (aa 21-81) Control Fragment Recombinant Protein

Recombinant Protein

ENCOMPASS_PREFERRED
Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human PGC (aa 21-81) Control Fragment
Recombinant Recombinant
57

Waters Corp 96-Flangeless SPE Cartridge Holder;

96-Flangeless SPE Cartridge Holder;

ENCOMPASS_PREFERRED
58

Phenomenex Inc 50mg/2mL/well

SAX 96-Well Plate SA0502-W

ENCOMPASS_PREFERRED
59

Waters Corp Oasis PRiME MCX 96-well Plate, 30 mg Sorbent per Well, 30 µm, 1/pk

Oasis PRiME MCX 96-well Plate, 30 mg Sorbent per Well, 30 µm, 1/pk

ENCOMPASS_PREFERRED
60

Med Vet International 30mg Vetoryl (Trilostane) Capsules, 30ct

THIS PRODUCT IS NOT RETURNABLE. Vetoryl Capsules contain an adrenosuppressant drug that is used to treat hyperadrenocorticism in dogs. Hyperadrenocorticism (also known as Cushing's disease) is a condition in which excess levels of the hormone cortisol are produced. This product is for oral use in dogs only

ENCOMPASS_PREFERRED